SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133574 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133574
Domain Number 1 Region: 552-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000152
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 2 Region: 344-481
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000361
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 476-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000001
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 4 Region: 514-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000251
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 5 Region: 590-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000357
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 6 Region: 159-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000397
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 769-808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000782
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 8 Region: 679-809
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000957
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 9 Region: 105-239
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000173
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 238-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000268
Family EGF-type module 0.033
Further Details:      
 
Domain Number 11 Region: 278-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000046
Family EGF-type module 0.017
Further Details:      
 
Domain Number 12 Region: 895-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000568
Family EGF-type module 0.029
Further Details:      
 
Domain Number 13 Region: 842-883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000129
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 14 Region: 809-850
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000661
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 33-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000552
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133574   Gene: ENSMUSG00000015468   Transcript: ENSMUST00000173389
Sequence length 978
Comment pep:known chromosome:GRCm38:17:34564337:34588231:1 gene:ENSMUSG00000015468 transcript:ENSMUST00000173389 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MQPQLLLLLLLPLNFPVILTRVSSPELLCGGSPEPCANGGTCLRLSRGQGICQCAPGFLG
ETCQFPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLE
ELCPPSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANGGVCLATYPQIQ
CRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACP
PGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYT
CLCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDC
AAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCI
CQPGYSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNEC
LSQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLC
LPGFTGARCEKDMDECSSTPCANGGRCRDQPGAFYCECLPGFEGPHCEKEVDECLSDPCP
VGASCLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCV
PAEDNCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPA
GYMGLTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNG
GTCVNKPGTFFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDTPRGARCLCSPGYTGS
SCQTLIDLCARKPCPHTARCLQSGPSFQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGL
CQNGGLCIDTGSSYFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPSGYVCQKIDSD
SLKLEMLIVVKYHVDAGN
Download sequence
Identical sequences G3UX69
ENSMUSP00000133574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]