SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133637 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133637
Domain Number 1 Region: 1321-1398
Classification Level Classification E-value
Superfamily Immunoglobulin 5.09e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 719-772
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000379
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 936-1009
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000812
Family I set domains 0.073
Further Details:      
 
Domain Number 4 Region: 431-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 486-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 583-637
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 7 Region: 1223-1299
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000529
Family I set domains 0.049
Further Details:      
 
Domain Number 8 Region: 87-135
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 9 Region: 772-832
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000327
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 1492-1558
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000114
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 11 Region: 829-893
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 1616-1670
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000235
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 13 Region: 1440-1497
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 
Domain Number 14 Region: 353-413
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000405
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 15 Region: 661-716
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000405
Family TSP-1 type 1 repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133637   Gene: ENSMUSG00000070469   Transcript: ENSMUST00000173287
Sequence length 1706
Comment pep:known chromosome:GRCm38:7:82335732:82614450:1 gene:ENSMUSG00000070469 transcript:ENSMUST00000173287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRETPMILDPMASWTGSWWLLTRMIFTVSGLLQATAEKSPGAYFLPEFALSPQGSFLE
DTTGEQFLTYRYDDQTSRNAHSEEDKDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGRNC
EGQNIRYKTCSNHDCPADAEDFRAQQCSAYNDVQYQGHYYEWIPLYNDPAAPCALKCHAR
GQSLVVELAPKVLDGTRCNADSLDMCISGICQIVGCDRQLGSNAKEDNCGVCAGDGSTCR
LVRGQTKMHLSPEKKEENVIAVPLGSRSVRITVKGPALIFIESKTLQGSRGEHSFNSPGV
FTVENTTIEFQKGADRQTFKIAGPLMADFIFKTRYTVAKGSVVQFFFYQPISHQWRQTDF
FPCTVTCGGGYQLNSAECMDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFK
EIMPYDHFQPLPRWEHNPWTACSVSCGGGIQRRSFVCVEESMHAEILQVEEWKCMYAPKP
TVMQACNLFDCPKWVAMEWSQCTVTCGRGLRYRVVLCINHRGQHVGGCNPQMKLHIKEEC
VIPIPCYKPREKSPVEAKLPWLKQAQELEETRIATEEPKFIPEPWSACSTTCGPGIQVRE
VRCRVLLTFTQTEAELPEEECEGPKPPTDRPCLRQACDQSPVSRELGGRLQEKDSEMTYD
WEYAGFTPCTATCLGGHQEAIAVCLHTQTHQTVNDSLCDTVHRPPPMSQACNMEPCPPRW
HMGSWGACSATCGVGIQTRDVYCLHPEEFPAPPEECREEKPHALRACNQFDCPPSWHIEE
WQQCSRTCGGGTQNRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPQLAAGD
WSKCSVTCGVGFQRRKQVCQKLTAKGRRVSVAETLCRDLPGLPLVRPCQMPICSKAKLGT
KTKLGERGPQILGVRRVYIQTREEKRINLTVGSRAYLLLNTSVIIKCPVRRFQKSLIQWE
KDGHCLKNSKQLGITKSGSLKIHSLAAPDIGVYRCIAGSAQETVVLKLIGTDNRLIAHPS
LREHVRGHPGVDHNEANSLGATWHKMRQMWNNKNDLYLHGGEMNKQPFLRALFGPCRTSE
GNDNSWEFKNKQFEAAMKQGAYSMDTAQFDELIRNMSQLMEMGEASDDLASQMIYQLVAE
LAKAQPTPVQWRGIREEVAPEAQLRGKTERVPKNPTVKNSGKLTFKPKGPVLMRQILPPS
VSFNKTINARIGNTVYITKSTEIINILCSLITPSKEATYTWTKDGALLQPSVKIILDETG
KMQIRNPTRKEQGIYECSVASHLGSDVESSLVLYAEAPVILSIERNVTKPEHNHLSVVVG
GTVEAALQANVTIHCPVKGVPQPNVTWLKTGGSLSDNVSLLFNGSLLLQSASLENEGTYI
CTATNALGKAVATSGLRLLERREPGGKAAFPKVQKTRVLQAPRSRINSNNLTGKSLPQEH
FWEPGNWTHCSATCGPLGFRLQRPRCVMASGQEVSEALCGPHRKPLAGFQSCNIRDCPAR
WFTSMWSECSASCGEGFHSRQVTCKQTKANGTVQVVSPRACAPKDRPLGRKPCSIRPCVQ
QAIDPGNQCPGRCMGHATRMQHHHTACSHNSSSSDCEDGRRPAFGRNCTLGPCEACWRVG
PWKPCTAVCGRGFQSRKVDCIHTGSCKIVADRYCVQVKPAAWRHCLGPSCDRNCTDTTHY
CMFVKHLNLCSLAVYRQRCCQSCQEG
Download sequence
Identical sequences G3UXC7
ENSMUSP00000133637 NP_001177303.1.92730 ENSMUSP00000133637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]