SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133678 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133678
Domain Number 1 Region: 14-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-19
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 264-363
Classification Level Classification E-value
Superfamily Nudix 1.88e-16
Family NADH pyrophosphatase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133678   Gene: ENSMUSG00000024228   Transcript: ENSMUST00000174122
Sequence length 367
Comment pep:known chromosome:GRCm38:17:59006395:59013268:-1 gene:ENSMUSG00000024228 transcript:ENSMUST00000174122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVKRNPKKEMISELHSSAAEGNVAKLAGILSHSPSLLNETSENGWTALMYAARNGHPD
VVQFLLEKGCDRSLVNKARQTALDIAAFWGYRHIANLLANAKGGKKPWFLTNEVDECENY
FSRTLLDRRSDKRNNSDWLQAKESHPTTVYLLFSDLNPLVTLGGNKESSQQPEVRLCQLN
YPDVKGYLAQPEKITLVFLGVELEMRKGSPAQAGGVPEEEEDGLVAWFALGIEPGAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGSATKIEEGGYKR
VCVRETCPSLQGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPG
KPILTGF
Download sequence
Identical sequences ENSMUSP00000133678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]