SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133775 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133775
Domain Number 1 Region: 181-453
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-78
Family Nuclear receptor ligand-binding domain 0.0000000017
Further Details:      
 
Domain Number 2 Region: 129-208
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.36e-30
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000133775
Domain Number - Region: 102-142
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.011
Family Hydrophobin II, HfbII 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133775   Gene: ENSMUSG00000039656   Transcript: ENSMUST00000174299
Sequence length 459
Comment pep:novel chromosome:GRCm38:17:34032183:34037700:1 gene:ENSMUSG00000039656 transcript:ENSMUST00000174299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGEAGRDGMGDSGRDSRSPDSSSPNPLSQGIRPSSPPGPPLTPSAPPPPMPPPPLGSPFP
VISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPP
PGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQR
NRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGDGAGGAPEEMPVDRILEAELAVEQK
SDQGVEGPGATGGGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRA
GWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRMD
KTELGCLRAIILFNPDAKGLSNPGEVEILREKVYASLETYCKQKYPEQQGRFAKLLLRLP
ALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences G3UXP8
ENSMUSP00000133775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]