SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133851 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133851
Domain Number 1 Region: 1138-1333
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.000026
Further Details:      
 
Domain Number 2 Region: 928-1051
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-31
Family Pleckstrin-homology domain (PH domain) 0.000000589
Further Details:      
 
Domain Number 3 Region: 42-167
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133851   Gene: ENSMUSG00000036591   Transcript: ENSMUST00000173194
Sequence length 1945
Comment pep:known chromosome:GRCm38:2:20847940:20967720:-1 gene:ENSMUSG00000036591 transcript:ENSMUST00000173194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATHWTGLPEEDGDKLKACGAASACEVSKNKDGKDQGEPVSPSEDEPFSWPGPKTVMLK
RTSQGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAF
EAGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVAYSQDAYLK
GNEAYSGNARNIPEPPPVCYPWLPSTPSATAQPVETCPPDSLPNKQQTSAPVLTQPGRAY
RMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLANRNNPSGPSHRTEEVRYG
VNEQASTKAASRTTSPASVPTAHLIHQTTGSRSLEPSGILLKSGNYSGHSEGISSSRSQA
VDSPPVSVNHYSANSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQSAADY
NQVVPTRTTLQVRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGALTSPP
VSFNNHRTRSWDYIEGQTEATATVNSESQIPDSNGERKQTYKWSGFTEQDDRRGIHERPR
QQEMHKPFRGSNLTVAPVVNSDNRRLVGRGVGPVSQFKKIPPDLRPPHSNRNFPTTTGVS
LQRGIAQDRSPLVKVRSNSLKVPPPPVSKPSFSQHSLASMKDQRPVNHLHQHSVLSQQTQ
FRSESTFEHQLETEVSSCLPGTSAKTSPQLSENLGTSDLELPAIPRNGDINLQEAEIQQP
DVLDNKESVILREKPQSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARREVHIKRM
EERKASSTSPPGDSLASIPFIDEPTSPSIDHEIAHIPASAVISASTAHVPSIATVPPSLT
TSAPLIRRQLSHDQESVGPPSLDGQHSSKTERSKSYDEGLDDYREDAKLSFKHVSSLKGI
KITDSQKSSEDSGSRKGSSSEVFSDAAREGWLQFRPLVTDKGKRVGGSIRPWKQMYVVLR
GHSLYLYKDRREQTTPSEEEQPISVNACLIDISYSETKRRNVFRLTTSDCECLFQAEDRD
DMLSWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLLSKTEQLPKTPRQSLSIRQTLL
GAKSEPKTQSPHSPKEESERKLLSKDDTSPPKDKGTWRRGIPSIVRKTFEKKPAATGTFG
VRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKGMADI
DIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLRTLKRLIHDL
PEHHFETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYK
IVETLIQHHDWFFTEEGAEEPLTAVQEENTVDSQPVPNIDHLLTNIGRTGVLPGDVSDSA
TSDSAKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDSVFFKKEN
TEQSHSEIKEESKRESETSGSKQRVVVAKESNTKKDSGTTKEEKKIPWEEPSPPHSSKRN
RSPTLSCRLAMLKEGPRSLLTQKPHCEETGSDSGTLLSTSSQASLLRSSTKKSTSPETKH
SEFLSIAGTTTSDYSTTSSTTYLTSLDSSRLSPEVQSVAESKGDEADDERSELVSEGRPV
ETDSESEFPVFPTTLTSDRLFRGKFQEVARVSRRNSEGSEASCTEGSLTPSLDSRRQQFS
SHRLIECDTLSRKKSARFKSDSGSPGDTRTEKETPALAKMFDVMKKGKSTGSLLTPSRSE
SEKQEATWKTKIADRLKLRPRAPADDMFGVGNQKPTAETAKRKNIKRRHTLGGHRDATEI
SVLSFWKAHEQSADKESELSAVNRLKPKCSAQDLSISDWLARERVRTSASDLSRGEGLEP
QAESPSVLGTPISTHSPPSQQPEARVAATSTLASTSQSPLFTPPQSPDQINRESFQNMSQ
NASSTANIHPHKQSESPDTKAETPP
Download sequence
Identical sequences B7ZCJ0
ENSMUSP00000133851 NP_001074833.3.92730 XP_006497608.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]