SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134175 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134175
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.8e-21
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 2 Region: 657-667
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000654
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134175   Gene: ENSMUSG00000024392   Transcript: ENSMUST00000172571
Sequence length 1082
Comment pep:novel chromosome:GRCm38:17:35135205:35147306:1 gene:ENSMUSG00000024392 transcript:ENSMUST00000172571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSDSASTAMEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTQLPSGASSGTGSASATHGGAPLPGTRGP
GASVHDRNANSYVMVGTFNLPSEPRVRLVMAQHMIRDIQTLLSRMECRGGTQAQASQPPP
QTPQTVASETVALNSQTSEPVESEAPPREPMESEEMEERPPTQTPELAPSGPAPAGPAPA
GPAPAPSHPSPAEHVEVLQELQRLQRRLQPFLQRYCEVLGAAATTDYNNNHEGREEDQRL
INLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYTTPMVLQQAAIPIQINVG
TTVTMTGNGARPPPAPGAEAATPGSAQATSLPPSSTTVDSSTEGAPPPGPAPPPASSHPR
VIRISHQSVEPVVMMHMNIQDSGAQPGGVPSAPTGPLGPPGHGQTLGQQVPGFPTAPTRV
VIARPTPPQARPSHPGGPPVSGALQGAGLGTNTSLAQMVSGLVGQLLMQPVLVAQGTPGM
AQAQAQAQAQAQAQAQAPAPAPAPAPAPATASASAGTTNTATTAGPAPGGPAQPPPPQPS
AADLQFSQLLGNLLGPAGPGAGGPGMASPTITVAMPGVPAFLQGMTDFLQASQTAPPPPP
PPPPPPPAPEQQSTPPPGSPSGGTASPGGLGPESLPPEFFTSVVQGVLSSLLGSLGARAG
SSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRL
QPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLEF
LQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRR
MSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQTLPEEPMEVQGAE
RTSPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASADAEPWAAAVPPEWVPI
IQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKLRSDIQKRLQEDPNYSPQRFPNAHRAFAD
DP
Download sequence
Identical sequences G3UYQ2
ENSMUSP00000134175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]