SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134203 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134203
Domain Number 1 Region: 70-186
Classification Level Classification E-value
Superfamily Ras GEF 6.8e-18
Family Ras GEF 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134203   Gene: ENSMUSG00000096798   Transcript: ENSMUST00000174320
Sequence length 315
Comment pep:putative chromosome:GRCm38:5:146167976:146170721:-1 gene:ENSMUSG00000096798 transcript:ENSMUST00000174320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCFQGSRGSGHKKAKRGFLVRFWRHLIRPLTHFRHASHSEPKVCSQNEQEPDSLPKRP
QFNYDSQEYIHQMIHYIPAAIQKRDHICITIFLGVYRTYASTWEVLDLLMRTYASFRPDC
IKDQQTKRAIFRFLFGWFKKYPQDFYESPDLAVVRQFIDYVKRNVPSSDVDRARELLSVL
EDQEAIELQIEQDFATAPEPSEQDASGRQETLAPRPASETEPQGDKQPREDPELVKGAIL
DPFEPKATIELPLSLHQAVPASDGTLSPVDVTADEATGVAADFAADVSPARQLFVSYTVQ
LGTPDFVFPLPEVDI
Download sequence
Identical sequences L7N481
ENSMUSP00000134203 XP_891827.1.92730 ENSMUSP00000134203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]