SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134263 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134263
Domain Number 1 Region: 24-211,296-453
Classification Level Classification E-value
Superfamily L domain-like 3.19e-63
Family Ngr ectodomain-like 0.00052
Further Details:      
 
Domain Number 2 Region: 503-670,726-879
Classification Level Classification E-value
Superfamily L domain-like 1.22e-45
Family Ngr ectodomain-like 0.00016
Further Details:      
 
Domain Number 3 Region: 1157-1346
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.28e-41
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 920-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000743
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 5 Region: 1085-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000804
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 6 Region: 962-1006
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000194
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 7 Region: 1050-1088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000158
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 8 Region: 999-1034
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000348
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1342-1383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000373
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134263   Gene: ENSMUSG00000031558   Transcript: ENSMUST00000174421
Sequence length 1542
Comment pep:novel chromosome:GRCm38:5:47984811:48304522:1 gene:ENSMUSG00000031558 transcript:ENSMUST00000174421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGIGWQTLSLSLGLVLSILNKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERL
DLNGNNITRITKIDFAGLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPE
LLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVL
TLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPS
HLRGHNVAEVQKREFVCSDEEEGHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPT
NLPETITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLY
GNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTVAKGTF
SALRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKF
RCSAKEQYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQRLNKIPDHIPQYTA
ELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLEN
VQHKMFKGLESLKTLMLRSNRISCVGNDSFIGLGSVRLLSLYDNQITTVAPGAFDSLHSL
STLNLLANPFNCNCHLAWLGEWLRRKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGN
DDNSCSPLSRCPSECTCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQFTLVPKELSNY
KHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGND
ISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKL
LLTTPSKKFTCQGPVDITIQAKCNPCLSNPCKNDGTCNNDPVDFYRCTCPYGFKGQDCDV
PIHACISNPCKHGGTCHLKEGENAGFWCTCADGFEGENCEVNIDDCEDNDCENNSTCVDG
INNYTCLCPPEYTAANLNEVEKGELCEEKLDFCAQDLNPCQHDSKCILTPKGFKCDCTPG
YIGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCVCPEGYSGLFCEFSPPMVLPRTSPCDN
FDCQNGAQCIIRINEPICQCLPGYLGEKCEKLVSVNFVNKESYLQIPSAKVRPQTNITLQ
IATDEDSGILLYKGDKDHIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLT
LDSSLSLSVDGGSPKVITNLSKQSTLNFDSPLYVGGMPGKNNVASLRQAPGQNGTSFHGC
IRNLYINSELQDFRKMPMQTGILPGCEPCHKKVCAHGMCQPSSQSGFTCECEEGWMGPLC
DQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQMIKCKHGKCR
LSGVGQPYCECNSGFTGDSCDREISCRGERIRDYYQKQQGYAACQTTKKVSRLECRGGCA
GGQCCGPLRSKRRKYSFECTDGSSFVDEVEKVVKCGCARCAS
Download sequence
Identical sequences G3UYX7
NP_001278156.1.92730 ENSMUSP00000134263 ENSMUSP00000133912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]