SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134378 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134378
Domain Number 1 Region: 81-328,630-648
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.74e-34
Family Calpain large subunit, catalytic domain (domain II) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000134378
Domain Number - Region: 784-853
Classification Level Classification E-value
Superfamily Globin-like 0.000347
Family Globins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134378   Gene: ENSMUSG00000050994   Transcript: ENSMUST00000172530
Sequence length 1657
Comment pep:putative chromosome:GRCm38:10:10335709:10472326:-1 gene:ENSMUSG00000050994 transcript:ENSMUST00000172530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKQAKRKEVHRINSAHGSDKSKDLYHFGSNVPPGSFEQKKGKFPIWPEWSEADINAEK
WDAGKGGKEKDKTAKSPIFHFFEDPEGKIELPQSLKVFSWKRPQDFIFSRTPVVVKNEIT
FDLFSPNEHLLCSELMRWIISEIYAVWKIFNGGILSNYHKGNLGELPILPWKPWEHIYSL
CKAVKGHVPLFNSYGKYVVKLYWMGCWRKITVDDFLPFDEENNLLLPATSYEFELWPMLL
SKAIIKLANVDVHVAHRRELGELTVIHALTGWLPEVIPLHPAYVDRVWELLKEILPEFKL
TEEPSSESKITTIDNKLKEATKENKDGKDGKNGKDLKDGKDMKDGKDGKDGKDGKDGKDG
KDEKADARDLGKKNKKDGEKEKEKFKFSLHGSRPSSDVQYSMQSLSECSSAIQLPHMVVY
ATFTPLYLFENKIFSLEKMANSAEKLREYGLSHICSHPVLVTRSRSCPLVSPPKPPPLPA
WKLIRHKKETVITDEAQDAVPKKPEQFLEISSPFLNYRMTPFTIPTETHFVQSVIKKGTP
LGSSLPPLVENDLVASTSQGEMSIVNGNQSQGNIALQITLGKDEPSEPALADFHQLEATS
LDRDLISLTTATLDKSQEELAINEGVAKEIWLDFEDFCVCFHHIYIFHKPHSYCLNFQKS
EFKFVEERVPYYLFVDSLKPIELLVCFSALVRWGESGALTKDSPPVEPGLLTAEAITWKS
LKPLSVVLRIHTYATKASVVRLPAGRHMLLFNAYSPVGHAIHVCSMTTFVIGDEDIVLPN
FEPESYRFTEQSIIIMKAIGNVIANFKDKGKLPAALRDLQAAHYPIPLNNKELTAQHFRV
FHISLWRLMKKSQVAKPPSNFKFAFRAMVFDTDLLDSFSEDVSLAEWVDLKYSTPINEKE
YTSEEIAAAVKIQSMWKGCYVRLLMKARKPETKENVTVADTLQKIWAVLEMNLEQYALSL
LRLMFKSKCKSMESYPCYQDEETKLAFADHTVNYADQPPNSWFIVFREIFLVPQDMIILP
KVYTTLPICILHVINNDTLEQVPKVFQKVVPFLYTKNKKGYTFVAEAYTGDTFVSGARWK
LRLIGSYNPLPFLARDSPCNTFSIKEIRDYYIPNDRKILFRYSIKVTVAQSITIQVRTSK
PDTFIKLQVLESEEVITSTVGKGQAVIPAFYFLGNEKALSSQSSKQVLLSHPSPKKDPEV
LTKKKSGQPGQKSFKGRSGGGLTDTGMPLLEEEILNIPTLEENSSTPQQCYKYIIQCLVL
FNSWPLNETQLTFVQALKDMEKMDIKEKHEEPAPMGSPDSHAVSEGQKSVGVPKTTRKGK
EKSAEKEKLAKEKQAPRFEPQQVQMPTAVHSQQEDPNKPYWILRLVSEHTDSDYVDVKKD
TERADEIRAMKQAWETTEPGRAIKAAQARLKYLTQFIKKPVTTDTTTSAPSPETLSVSQS
QTKSSEEGELDTGKYADIKELPPNAAGSVLWKKWQMTKTITSLTKFTSSESVPKEEPPQK
EIPVVRQRSPTILETSPQQIRKALEFLDFSHYVRKTAAEAVLQTEELNKQQAMQKAEEIH
QFRQHRSRILSIRDIDQEERFKQKDEVLEMYGEMRDSVDEARQKILDIREVYRNKLLEAE
RLRMEALAAQEAAVKIEIEKKSPASDSQKKKKVGKKK
Download sequence
Identical sequences G3UZ78
10090.ENSMUSP00000123171 ENSMUSP00000134378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]