SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134543 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134543
Domain Number 1 Region: 35-180
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-28
Family GRAM domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134543   Gene: ENSMUSG00000030522   Transcript: ENSMUST00000174210
Sequence length 190
Comment pep:known chromosome:GRCm38:7:64287782:64338029:1 gene:ENSMUSG00000030522 transcript:ENSMUST00000174210 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MFSLKPPRPSFRSYLLPPAQTDDKISSEPKIKKLEPVLLPGEIVVNEVNFVRKCIATDTS
QYDLWGKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKV
LGPNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEY
VGKKYHNSEA
Download sequence
Identical sequences A0A0U1RQ60
ENSMUSP00000134543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]