SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000137013 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000137013
Domain Number 1 Region: 17-287
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-88
Family Protein kinases, catalytic subunit 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000137013   Gene: ENSMUSG00000095190   Transcript: ENSMUST00000179491
Sequence length 301
Comment pep:known chromosome:GRCm38:7:20724919:20725824:-1 gene:ENSMUSG00000095190 transcript:ENSMUST00000179491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEQDLKMMEQDLKACYSIEENFDTNYKMLNTLGEGKFSVVKRAFHVPTSTSVAVKILQN
TKEYTSPICREARIMKSLSHPNIIKLFHVVQRRETTYLVMEYASEGELQDRIIKVGSLEE
SETRRLFAQIVHAVQYCHDHHIVHRDIKASNILIDYRGNAKLCDFGLAAEVIPGQKLAGF
CGTLPYCAPELLQAEKYEGPPVDIWSLGVLLFLMVSGNLPFQGRYFVDLKQEIISANFSI
PSHVSIDILNVIIELLMINPSRRPTIHQIMRHPMIRGSEACLPPTSTQISQAPQATALSG
P
Download sequence
Identical sequences Q3UTA8
ENSMUSP00000136041 ENSMUSP00000136627 ENSMUSP00000137013 10090.ENSMUSP00000096306 10090.ENSMUSP00000096315 10090.ENSMUSP00000096327 10090.ENSMUSP00000096331 ENSMUSP00000096306 ENSMUSP00000096315 ENSMUSP00000096331 ENSMUSP00000130469 NP_001032325.1.92730 NP_001257423.1.92730 XP_017167970.1.92730 ENSMUSP00000136041 ENSMUSP00000136627 ENSMUSP00000137013 ENSMUSP00000140310 ENSMUSP00000140400 ENSMUSP00000140440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]