SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000137187 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000137187
Domain Number - Region: 39-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00641
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000137187   Gene: ENSMUSG00000094430   Transcript: ENSMUST00000179384
Sequence length 141
Comment pep:putative chromosome:GRCm38:16:32804760:32810477:-1 gene:ENSMUSG00000094430 transcript:ENSMUST00000179384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWFAFLLLLWLGPVIPNQKAGSCSQPQPLCCPGEDYGCKRGNCYCDKFCRVLSDCCPDHE
TLCNSSDLHAGSLPPVAQLDAVTHRAFHTPKMVLQMVLRTERPLDSARNNQDLVQNMVLQ
LLHSLSRRPLSVTMKGIRKRA
Download sequence
Identical sequences J3QPC1
ENSMUSP00000137187 ENSMUSP00000137187 NP_001243238.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]