SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138025 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138025
Domain Number 1 Region: 9-184
Classification Level Classification E-value
Superfamily RUN domain-like 1.44e-41
Family RUN domain 0.0013
Further Details:      
 
Domain Number 2 Region: 659-750
Classification Level Classification E-value
Superfamily PX domain 6.28e-25
Family PX domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138025   Gene: ENSMUSG00000071669   Transcript: ENSMUST00000180792
Sequence length 818
Comment pep:novel chromosome:GRCm38:16:11322908:11755472:1 gene:ENSMUSG00000071669 transcript:ENSMUST00000180792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSQNDDRRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGMKRS
RGLALTAAAIKQAAGFTSKTETEPVFWVYVKEVLNKHELQRFYSLHHITSDAGRGRAWLR
CALNEHSLERYLHMLLADRARLSTFYEDWSFVMDEERSSMLPTMAAGLNSILFAINIDNK
DLNGQSKFAPTVSDLLKESTQNVTSLLKESTQGMSSLLREITASSAVSILIKPEQETDPL
PVISKNVHVDTRCKRERRRRKKVTNIVSFDDDEEEQGTGDTLKKMPGTAESSEENSDRSS
VNIMAAFEGTFGPNSNGSQSSSSWKIDSASLNGELGYQKLDVKSIDDDVDENEEDAYRSP
LGRGHTGHAESPDRTLDGNACLAQVHGWAPLQVLHGDADADTDVLFPVSGVGSYGAADAP
VGSLENGTGTENHIIPEPGLRYREASSPGQGSPLSSLLPSASVPESMTVHELRQAIVAMM
NRKDELEEENGSLRNLLDGEMEHSAALRQEVDALRRKVTEQQERHATKVQALARENEVLK
VQLKKYVGAVQMLKREGQTAEAVPSLWNVDAEVTVPEQKPGEVAEELASSYERKLIEVAE
MHGELIEFNERLHRALVAKEALVSQMRQELIDLRGPVPGDLSQTSEDQSLSDFEISNRAL
INVWIPSVFLRGKAANAFHVYQVYIRIKDDEWNVYRRYTEFRALHHQLQSAFPQVRAYSF
PPKKAIGNKDAKFVEERRKQLQSYLRSVMNKVIQMVPEFAANPKKETLVQLVPFFVDITP
PGEPLNKSSRPKAVSRFPKLSRGHPREVRNVEPQSGDL
Download sequence
Identical sequences Q9D3S3
NP_083240.2.92730 ENSMUSP00000138025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]