SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138271 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138271
Domain Number 1 Region: 117-209
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.38e-34
Family SCAN domain 0.00000843
Further Details:      
 
Domain Number 2 Region: 714-770
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 602-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 657-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.75e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 486-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-17
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 759-811
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.17e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 564-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000677
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138271   Gene: ENSMUSG00000030380   Transcript: ENSMUST00000182490
Sequence length 814
Comment pep:putative chromosome:GRCm38:7:13043147:13053684:-1 gene:ENSMUSG00000030380 transcript:ENSMUST00000182490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSTKHMAHIEFPRISGVWLACQCLFPRVSSSWRRSRMKGHSMALSQHSLPLAVLITHAL
YYSFPRDRHWPQRPDLVLLMRPTVLGSSGCAPPENEPALVKLEDSDSDDEREDILWDPGL
EAARLRFRCFRYEDAIGPQEALAQLRELCHQWLRPEVHSKEQVLELLVLEQFLGALPPEI
QAQVQGQWPGSPEEAAALVDRLRWELDGPRKWVTVQVQGKEVLSEKMEPSSFQPRPHIKL
QTPDPGAETPQGAMQELPLNLPMKEETELLGNPELLESGPLPAAQEAAATLLPKETQGHG
TTLDQTSPHSDTEPDVPPWSEDPMPLWHEEVGGIFSPGFTLQMDSITAEPDMMSPHLHVP
WDLDMASLSGQIQSPTTEGGFAHALVLPSDPGGEQDPACEDPCPSVGPALVATRWHAPRG
RSQSHPRSGTGAMRGGRCDVCGKVFSQRSNLLRHQKIHTGERPFVCGECGRSFSRSSHLL
RHQLTHTEERPFVCRDCGQGFVRSARLEEHRRVHTGEQPFRCTECGQSFRQRSNLLQHQR
IHGDPPGPAPSILPLAGVPEPPGPFPCSECCESFPRRAVLLEHQAVHTGDKSFGCVECGE
RFGRRSVLLQHRRVHSGERPFACAECGQSFRQRSNLTQHQRIHTGERPFACAECGKTFRQ
RPTLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQRTHTGEKPYCCGECGLGFTQVSRL
TEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHL
RTHRHEKPFACQDCGRRFNQSTKLIQHQRVHSTE
Download sequence
Identical sequences S4R1L6
ENSMUSP00000138271 10090.ENSMUSP00000005709 XP_006539528.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]