SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138283 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138283
Domain Number 1 Region: 8-144
Classification Level Classification E-value
Superfamily Caspase-like 3.72e-23
Family Caspase catalytic domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138283   Gene: ENSMUSG00000067882   Transcript: ENSMUST00000182769
Sequence length 180
Comment pep:known chromosome:GRCm38:17:23550965:23553566:-1 gene:ENSMUSG00000067882 transcript:ENSMUST00000182769 gene_biotype:polymorphic_pseudogene transcript_biotype:polymorphic_pseudogene
Sequence
MAHREPQGQLLGGDGQEVQAEVLVQELSCCQALHGHPKIFLLQVCCGGNRDPGVGSRALP
WYRHWLRAPRAIPTQADVLQIHADAPDNLISTPGSSGQADILTVSAAVEGCVAYRDEKGS
DFVQTLVEVIRANPGRDLLELLTEGQQAGVXAGRPGARQXXAVQSLPGDPQLAQAPALFI
Download sequence
Identical sequences ENSMUSP00000138283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]