SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138387 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138387
Domain Number 1 Region: 38-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.06e-34
Family SCAN domain 0.00000843
Further Details:      
 
Domain Number 2 Region: 635-691
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.22e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 523-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.72e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 578-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 407-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-17
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 680-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.78e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 485-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000558
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138387   Gene: ENSMUSG00000030380   Transcript: ENSMUST00000182515
Sequence length 735
Comment pep:known chromosome:GRCm38:7:13042361:13054665:-1 gene:ENSMUSG00000030380 transcript:ENSMUST00000182515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPTVLGSSGCAPPENEPALVKLEDSDSDDEREDILWDPGLEAARLRFRCFRYEDAIGPQ
EALAQLRELCHQWLRPEVHSKEQVLELLVLEQFLGALPPEIQAQVQGQWPGSPEEAAALV
DRLRWELDGPRKWVTVQVQGKEVLSEKMEPSSFQPRPHIKLQTPDPGAETPQGAMQELPL
NLPMKEETELLGNPELLESGPLPAAQEAAATLLPKETQGHGTTLDQTSPHSDTEPDVPPW
SEDPMPLWHEEVGGIFSPGFTLQMDSITAEPDMMSPHLHVPWDLDMASLSGQIQSPTTEG
GFAHALVLPSDPGGEQDPACEDPCPSVGPALVATRWHAPRGRSQSHPRSGTGAMRGGRCD
VCGKVFSQRSNLLRHQKIHTGERPFVCGECGRSFSRSSHLLRHQLTHTEERPFVCRDCGQ
GFVRSARLEEHRRVHTGEQPFRCTECGQSFRQRSNLLQHQRIHGDPPGPAPSILPLAGVP
EPPGPFPCSECCESFPRRAVLLEHQAVHTGDKSFGCVECGERFGRRSVLLQHRRVHSGER
PFACAECGQSFRQRSNLTQHQRIHTGERPFACAECGKTFRQRPTLTQHLRVHTGEKPFAC
PECGQRFSQRLKLTRHQRTHTGEKPYCCGECGLGFTQVSRLTEHQRIHTGERPFACPECG
QSFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRHEKPFACQDCGRRFN
QSTKLIQHQRVHSTE
Download sequence
Identical sequences A1L358
ENSMUSP00000069122 ENSMUSP00000138387 ENSMUSP00000069122 NP_665818.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]