SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138465 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138465
Domain Number 1 Region: 114-196
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.01e-31
Family Nuclear receptor 0.0000808
Further Details:      
 
Domain Number 2 Region: 166-193,338-493
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.42e-29
Family Nuclear receptor ligand-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138465   Gene: ENSMUSG00000005893   Transcript: ENSMUST00000146175
Sequence length 501
Comment pep:known chromosome:GRCm38:6:92139796:92168668:1 gene:ENSMUSG00000005893 transcript:ENSMUST00000146175 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MTSPSPRIQIISTDSAVASPQRIQIVTDQQTGQKIQIVTAVDASGSSKQQFILTSPDGAG
TGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKADVQRPQVVEYCVVC
GDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSSQDCIINKHHRNRCQFCRLKKCLEM
GMKMESVQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGARQTGLL
DPGMLVNIQQPLIREDGTVLLAADSKAETSQGALGTLANVVTSLANLSESLNNGDASEMQ
PEDQSASEITRAFDTLAKALNTTDSASPPSLADGIDASGGGSIHVISRDQSTPIIEVEGP
LLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVR
ACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCN
SMAKLDIDGYESSRFDRHKPD
Download sequence
Identical sequences Q3ZAR9
ENSMUSP00000138465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]