SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138637 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138637
Domain Number 1 Region: 166-244
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-26
Family Nuclear receptor 0.0000216
Further Details:      
 
Domain Number 2 Region: 217-230,272-338
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000000275
Family Nuclear receptor ligand-binding domain 0.000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138637   Gene: ENSMUSG00000021055   Transcript: ENSMUST00000133564
Sequence length 362
Comment pep:known chromosome:GRCm38:12:76120419:76177259:-1 gene:ENSMUSG00000021055 transcript:ENSMUST00000133564 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSICASSHKDFSQLRPTQDMEIKNSPSSLTSPASYNCSQSILPLEHGPIYIPSSYVESRH
EYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWPTSGHLSPLATHCQSSLLYAE
PQKSPWCEARSLEHTLPVNRETLKRKLGGSGCASPVTSPSAKRDAHFCAVCSDYASGYHY
GVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRR
ERCGYRIVRRQRSASEQVHCLNKAKRTSGHTPRVKELLLNSLSPEQLVLTLLEAEPPNVL
VSRPSMPFTEASMMMSLTKLADKELVHMIGWAKKIPGMRGSAWKGFWKSLTCSWRRRHGS
VS
Download sequence
Identical sequences ENSMUSP00000138637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]