SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139028 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139028
Domain Number 1 Region: 1438-1576
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.02e-59
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000237
Further Details:      
 
Domain Number 2 Region: 234-338
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000063
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139028   Gene: ENSMUSG00000026933   Transcript: ENSMUST00000183461
Sequence length 1581
Comment pep:known chromosome:GRCm38:2:25929726:25983282:-1 gene:ENSMUSG00000026933 transcript:ENSMUST00000183461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDAGGRCAAEGWRRMEAPPEGADLVPLDRYDAARAKIAANLQWICAKAYGLDNIPEDLR
DPFYIDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQVATLQGHQSVIQALSRKGIYV
MESDDTPVTDADLSQAPIKMSGHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKEL
PYDLEDAMVFWINKVNLKMREITEKEVKLKQQPLESPAHQKVRYRREHLSARQSPYFPLL
EDLMRDGSDGAALLAVVHYYCPEQMKLDDICLKEVPSMADSLYNIRLLREFSNEHLNKCF
YLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDIQELKDAKTVLQQKSSRPP
VPISNATKRSFLGSPAAMSPADQPPSTQPLAEGSHRYHLHSEEPECLGKGASTFSPSHPL
LPLRQKQQKVSQTEEIPDQRHRSNSLTRVDGQPRGAIGAWPDKKNRPVSQPTSFALHHAA
SCDVDPSSGDSVSLARSISKDSLASNIIHLTPQNQPHPSAGKSNGKSLLSNVNIEDEDEE
LVAIIRTDVSPPSPQMPRTSPQAPGLVASIRSPQRQADTLESKPDSFYLEPLMPAVLRPA
KEKQITTKEDERGEGRPRTIMAKRPSEGSQPMVRKKVSGGHGSRDLNRTFTPIPCSEFAA
SIDLAEVGPQSAEATGEGQPLALGRFDTLPQGQAADGFFLHVGRAEEDEGRWYVGSQSPS
SHDSEPWTILRQDSDSDVVDVEDTEQDFIGEDHPVVIPRYAGEEESAKLQEDMKVKEHED
KDDASGRSSPCLSTTSQLSSMSMASGSVKMTSFAERKLQRLNSCETKSSTSSSQKTTPDA
SESCPAPLTTWRQKREQSPGRHSKDPASLLASELVQLHMQLEEKRRAIEAQKKKMEALSA
RQRLKLGKAAFLHVVKKGKADGAPQPLRPEHFTKEFTQHNGEDLDDGTCKTEGFLVKEEQ
RDLSDAQDVAFVQLHKPRDPAALHDGEKHRMISTALLEDSVGEVDVNECDLSIEKLNETI
STLQQAILKISQQQEQLLMKSPTVPTPGTKNNCQDQKIKAPVHFVEPLSPTGVPGHRKPP
RLGQGRNSRSGRPAELKVPKDRQQGCSRSKTPTPSVETLPQSRSLPPSTHPRSPSDPGGE
LPEKCLFDSYRLHDESNHRTFVLSSCKDANIVSEQVNFKEGLDTSVKEAGLSSSTITGKE
HTPVEEPLRSKASLIEVDLSDLKAPDEDGEVVGHESSVELGGDSDQKPGVGFFFKDEQKA
EDELAKKRAAFLLKQQRKAEEARARKQQLEAEVELKRDEARRKAEEDRLRKEEEKARREL
IKQEYLRRKQQQALEEQGLGKPKSKPKKPRPKSVHREESYSDSGTKCSSTHNLSQTHSGS
SLSLASAATTEPESVYSGGTPSHRVESLEALPILSRNPSRSTDRDWETASAASSLASVAE
YTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILELEKCDANHYIILFRDAGC
QFRALYCYQPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNLIPAKTMSVSVDALT
IHNHLWQPKRPTVPKKTQTRK
Download sequence
Identical sequences A2AHC3
10090.ENSMUSP00000088812 ENSMUSP00000088812 ENSMUSP00000088812 ENSMUSP00000139028 ENSMUSP00000088812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]