SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139278 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139278
Domain Number 1 Region: 24-179
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.37e-31
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139278   Gene: ENSMUSG00000027333   Transcript: ENSMUST00000183947
Sequence length 209
Comment pep:known chromosome:GRCm38:2:131491943:131525172:1 gene:ENSMUSG00000027333 transcript:ENSMUST00000183947 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAARALLEQGFTDVTVLEASSHI
GGRVQSVRLGDTTFELGATWIHGSHGNPIYQLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNRGCRIPKDVVEEFSDLYNEVYNMTQEFFRHGKPVNAESQNSVGVFTREKVRNRI
RDDPDDTEATKRLKLAMIQQYLKSAMAMC
Download sequence
Identical sequences ENSMUSP00000139278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]