SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139640 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139640
Domain Number 1 Region: 613-907
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.24e-83
Family Protein kinases, catalytic subunit 0.000000000528
Further Details:      
 
Domain Number 2 Region: 30-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-74
Family Ephrin receptor ligand binding domain 0.000000854
Further Details:      
 
Domain Number 3 Region: 328-532
Classification Level Classification E-value
Superfamily Fibronectin type III 4.61e-40
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 4 Region: 910-982
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.49e-21
Family SAM (sterile alpha motif) domain 0.0000346
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000139640
Domain Number - Region: 259-330,366-389
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000243
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139640   Gene: ENSMUSG00000026235   Transcript: ENSMUST00000188952
Sequence length 986
Comment pep:known chromosome:GRCm38:1:77367189:77515079:-1 gene:ENSMUSG00000026235 transcript:ENSMUST00000188952 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAGIFYFILFSFLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEASQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRESQFGKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEEQNGECQACKIGYYKALSTDASCAKCPPHSYSV
WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVS
KYNPSPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF
TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGSESSRPNT
ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMSQDDLARIGITAIT
HQNKILSSVQAMRTQMQQMHGRMVPV
Download sequence
Identical sequences Q03137
NP_031962.2.92730 ENSMUSP00000027451 ENSMUSP00000027451 ENSMUSP00000139640 ENSMUSP00000140954 10090.ENSMUSP00000027451 ENSMUSP00000027451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]