SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140124 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140124
Domain Number 1 Region: 610-636,667-906
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.06e-61
Family Nuclear receptor ligand-binding domain 0.00000000175
Further Details:      
 
Domain Number 2 Region: 557-635
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-23
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140124   Gene: ENSMUSG00000031870   Transcript: ENSMUST00000189181
Sequence length 926
Comment pep:known chromosome:GRCm38:9:8899833:8968611:1 gene:ENSMUSG00000031870 transcript:ENSMUST00000189181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELQAKDPQVLHTSGASPSPPHIGSPLLARLDSGPFQGSQHSDVSSVVSPIPISLDGLL
FPRSCRGPELPDGKTGDQQSLSDVEGAFSGVEATHREGGRNSRAPEKDSRLLDSVLDSLL
TPSGTEQSHASPPACEAITSWCLFGPELPEDPRSVPATKGLLSPLMSRPEIKAGDSSGTG
AGQKVLPKGLSPPRQLLLPTSGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKS
KPRALEGTGSGGGVAANAASAAPGGVTLVPKEDSRFSAPRVSLEQDSPIAPGRSPLATTV
VDFIHVPILPLNHALLAARTRQLLEGDSYDGGATAQGPFAPPRGSPSAPSPPVPCGDFPD
CTYPLEGDPKEDVFPLYGDFQTPGLKIKEEEEGADAAVRSPRPYLSAGASSSTFPDFPLA
PAPQRAPSSRPGEAAVAGGPSSAAVSPASSSGSALECILYKAEGAPPTQGSFAPLPCKPP
AAGSCLLPRDSLPAAPATAAAPAIYQPLGLNGLPQLGYQAAVLKDSLPQVYPPYLNYLRP
DSEASQSPQYGFDSLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRN
DCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRTLDGVALPQSVGLPNESQ
ALGQRITFSPNQEIQLVPPLINLLMSIEPDVVYAGHDNTKPDTSSSLLTSLNQLGERQLL
SVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQ
RMKELSFYSLCLTMWQIPQEFVKLQVTHEEFLCMKVLLLLNTIPLEGLRSQSQFEEMRSS
YIRELIKAIGLRQKGVVPSSQRFYQLTKLLDSLHDLVKQLHLYCLNTFIQSRTLAVEFPE
MMSEVIAAQLPKILAGMVKPLLFHKK
Download sequence
Identical sequences Q00175
ENSMUSP00000063562 10090.ENSMUSP00000063562 NP_032855.2.92730 ENSMUSP00000063562 ENSMUSP00000063562 ENSMUSP00000140124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]