SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140546 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140546
Domain Number 1 Region: 246-500
Classification Level Classification E-value
Superfamily Caspase-like 1.2e-87
Family Caspase catalytic domain 0.00000000496
Further Details:      
 
Domain Number 2 Region: 21-137
Classification Level Classification E-value
Superfamily DEATH domain 3.45e-32
Family DEATH effector domain, DED 0.0028
Further Details:      
 
Domain Number 3 Region: 118-199
Classification Level Classification E-value
Superfamily DEATH domain 7.77e-19
Family DEATH effector domain, DED 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140546   Gene: ENSMUSG00000026029   Transcript: ENSMUST00000191201
Sequence length 500
Comment pep:known chromosome:GRCm38:1:58795477:58846754:1 gene:ENSMUSG00000026029 transcript:ENSMUST00000191201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVLLELLSDWLQLFYLLIRMDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIED
AQKLFLRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDPDNAQISP
YRVMLFKLSEEVSELELRSFKFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLETL
KSICDQVNKSLLGKIEDYERSSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQDSE
SRTSDKVYQMKNKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELH
FEIVSYDDCTANEIHEILEGYQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTS
YFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKNYIPDEAD
FLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDRRN
KGKQMPQPTFTLRKKLFFPP
Download sequence
Identical sequences A0A087WQT6
ENSMUSP00000140335 ENSMUSP00000140546 NP_001264855.1.92730 XP_006495697.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]