SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140716 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140716
Domain Number 1 Region: 811-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000921
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 2 Region: 372-393,436-534,719-734
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000152
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 861-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000318
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 4 Region: 914-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000725
Family Laminin-type module 0.004
Further Details:      
 
Domain Number 5 Region: 283-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000178
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 6 Region: 753-805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 7 Region: 1056-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 963-1012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 9 Region: 1010-1053
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 10 Region: 85-164
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000553
Family APC10-like 0.053
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000140716
Domain Number - Region: 1118-1159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000137
Family Laminin-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140716   Gene: ENSMUSG00000019899   Transcript: ENSMUST00000189575
Sequence length 1349
Comment pep:putative chromosome:GRCm38:10:27187548:27616796:-1 gene:ENSMUSG00000019899 transcript:ENSMUST00000189575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAATAGILLLLLLGTLEGSQTQRRQSQAHQQRGLFPAVLNLASNALITTNATCGEKGPE
MYCKLVEHVPGQPVRNPQCRICNQNSSNPYQRHPITNAIDGKNTWWQSPSIKNGVEYHYV
TITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYP
RTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARYIRLR
FQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPATNK
SRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNCHGKAEECYYDETVASRNL
SLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTGSLSE
VCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYPDCQPCNCSGLGSTNEDPCVG
PCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECFCSGVSNRCQSSYWTYGNIQDMRGWY
LTDLSGRIRMAPQLDNPDSPQQISISNSEARKSLLDGYYWSAPPPYLGNRLPAVGGQLSF
TISYDLEEEEDDTEKILQLMIIFEGNDLRISTAYKEVYLEPSEEHIEEVSLKEEAFTIHG
TNLPVTRKDFMIVLTNLERVLMQITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVC
QCPPGYSGSSCETCWPRHRRVNGTIFGGICEPCQCFAHAEACDDITGECLNCKDHTGGPY
CNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRC
ERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADG
YFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQLGRGC
LPCNCNSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCSHLGNNCD
PKTGQCICPPNTTGEKCSECLPNTWGHSIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPK
FSGMKCSECSRGHWNYPLCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVH
CDRCRPGKFGLDAKNPLGCSSCYCFGVTSQCSEAKGLIRTWVTLSDEQTILPLVDEALQH
TTTKGIAFQKPEIVAKMDEVRQELHLEPFYWKLPQQFEGKKLMAYGGKLKYAIYFEARDE
TGFATYKPQVIIRGGTPTHARIITRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRISRTV
TREDFLDILYDIHYILIKATYGNVVRQSR
Download sequence
Identical sequences A0A087WRP2
ENSMUSP00000140716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]