SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000141182 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000141182
Domain Number 1 Region: 9-297
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-46
Family WD40-repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 1002-1060
Classification Level Classification E-value
Superfamily HMG-box 0.0000000641
Family HMG-box 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000141182   Gene: ENSMUSG00000037572   Transcript: ENSMUST00000187531
Sequence length 1117
Comment pep:known chromosome:GRCm38:14:47240945:47276857:-1 gene:ENSMUSG00000037572 transcript:ENSMUST00000187531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATQKPMRYGHTEGHTEVCFDDSGSYIVTCGSDGDVRMWEDLDDDDPKSVNVGEKAFSC
ALKNGKLVTAVSNNTVQVYTFPEGVPDGILTRFTTNANHVVFNGAGNKIAAGSSDFLVKV
VDVMDNSQQQTFRGHDAPVLSLSFDPKDIFLASASCDGTVRVWNISDQTCAVSWPVLQKS
NDVVNAKSICRLAWQPKAGKLLAVPVEKSVKLYRRETWSNPFDLSDSSISQTLNIVTWSP
CGQYLAAGAINGLIVVWNVETKDCMERVKHEKGYAICGLAWHPTCSRICYTDVEGNLGVL
ENVCDLSGKVSSNKVSSRVEKDYNDLFDGDDTSSAGDFLNDNAVEIPSFSKGIINEDDDN
DDIMLAADHDLGDDENSVDVTMLKADLSHKEEGDDDQARSIHNLPLIRPQRPFYDGPMPT
PRQKPFQSSSTPLHLSHRFMVWNSVGIIRCYNDDQDSAIDVEFHDTSIHHATHLLNAFNY
TMGTLSHEAILLACESADELASKLHCLHFSSWDSSKEWMVDMPQNEDIEAICLGLGWAAA
ATTALLLRLFTIGGVQKEVFCLPGPVVSMAGHGEQLCIVYHRGTGFDGDQCLGVQLLELG
RKKNQVLHGDPLPLTRKSYLTWLGFSAEGTPCYVDSEGCVRMLNRGLGNTWTPVCNIREH
CKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAILSFKLPYCQTSTEKGQMEE
QFWHSVLFHNYLDYLAKNGYDYEESIKNQAVKEQQELLMKMLALSCKLEREFRCVELADL
MTQNAVHLAIKYASRSRKLILAQKLSELAAEKAAELAETQSEEEKEEDFREKLNAGYSHT
TTEWSRPRVRSQVEDAEDREDTVSEEKPESHNHGQNLFQSANSSDTPALKSGAVFSSSQG
WVNPFKVVVSSKEPAVSANSTRSANILDSMNKSSRKSTSLNRMENNEKSPVIKPLTPKPR
SKQASAASYFQKRTPQADKTEEVKENPKSSSSDAPAVCLQNSENQRPKTGFQMWLEENRS
QILSDNPDISDETDIIKEGMIRFRVLSAEERKAWTNKAKGETASDGAEAKKRKRVVSEIC
ETENQEETVKENLDLSKKQKALNLPANQKLSAFAFKQ
Download sequence
Identical sequences P59328
ENSMUSP00000141182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]