SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20093575|ref|NP_613422.1| from Methanopyrus kandleri AV19

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20093575|ref|NP_613422.1|
Domain Number 1 Region: 163-212,306-543
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000000000000471
Family Terpene synthases 0.044
Further Details:      
 
Weak hits

Sequence:  gi|20093575|ref|NP_613422.1|
Domain Number - Region: 562-628
Classification Level Classification E-value
Superfamily E set domains 0.00207
Family Filamin repeat (rod domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20093575|ref|NP_613422.1|
Sequence length 667
Comment Terpene cyclase/mutase [Methanopyrus kandleri AV19]
Sequence
MRQLLVILCCVTAIGPVSAATLEDADQCLKDSVVWLVENQFTEQDVGKTYTLRDPGGTYN
GKQYEVHFATEQDGQLQDEGVASRDFTVEDVDVGTWPTTYKGDCRVIYVKKYNYFPSDYG
LETVKLGDKIVALIDNSKCVIYVKKNDKYGYVGFGGEPGYSDTKFTVPMLVLAVEEGVTD
EQFKNAVKRAIKWVLTVSSPRGYYYQYSLKDIRTTLEESGYIRTGSIGGVCLYQLIPLLV
GRELGLVDDDLWNSVKDDAVYVIKNGILVPEVYCSSKQDKKDVLIVDSKNEIAYWVRQRL
KDDTWVDYSAVYDTAGAVLTLIYAVKTGLISGDDDVDVGGSTYKVADIIKYAVNFLVERF
YEGNGNPCFLEKQAVEQGLYWKSYYYPVKYAFYALWAIREAEKAGYLSDKAKDLLHDALR
RYVCWLYGMQLEDKPGYFPYNEYIKGSPDFASTCAALLGLCTAVELGYEDDMAIQLMKNV
VNALVSQYKEAKEKGLKYYFYVPTPQSYYYLYMSRFFEGREANQCAFATAHVVAALAAVE
GLPESVRSEIFGHTVELKVEVPRETRVGTPVTIQIEVTIDGQPASSGEVRVYEGDRIIGV
ADVSDGKATITYTPEKRGEHRLKIEYRDPKYGVKSTTIVIKAKKKAPAVSPAVAALSVLA
LALRRRP
Download sequence
Identical sequences Q8TZ06
190192.MK0135 gi|20093575|ref|NP_613422.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]