SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20094053|ref|NP_613900.1| from Methanopyrus kandleri AV19

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20094053|ref|NP_613900.1|
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Vng1086c-like 3.01e-24
Family Vng1086c-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20094053|ref|NP_613900.1|
Sequence length 103
Comment metal-binding protein [Methanopyrus kandleri AV19]
Sequence
MKKDELFLLHSVLYYVLEYLKMEGKTREDDVKLYDEFNVKPGHLHKTKLQHKCAVFLLAY
VIARAISSELPKAEGLGQRLGKLLEELFEELKRRGEEVPVEPP
Download sequence
Identical sequences Q8TXP5
190192.MK0615 gi|20094053|ref|NP_613900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]