SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20094233|ref|NP_614080.1| from Methanopyrus kandleri AV19

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20094233|ref|NP_614080.1|
Domain Number 1 Region: 318-367
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000628
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.005
Further Details:      
 
Domain Number 2 Region: 375-501
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.00000141
Family Cyclophilin (peptidylprolyl isomerase) 0.041
Further Details:      
 
Weak hits

Sequence:  gi|20094233|ref|NP_614080.1|
Domain Number - Region: 231-307
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.0038
Family Outer surface protein, C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20094233|ref|NP_614080.1|
Sequence length 511
Comment hypothetical protein MK0796 [Methanopyrus kandleri AV19]
Sequence
MRVYVDGEPVDVPEEATVRDALEAAGVSVPEDVTIAVFKGEQKVERETDRLRIMLETGDE
ELSLTVAVEDERMSEVCEELPGASVSWTTRDEVGLGPVDVSDLEFHTRRGVEVPPYTAIL
ILPTNDPSEAYFLITKRRMAVEYICTDIHGRVTAGRELVDELRGGERVTHVEPVVERATE
RVVSRVTLDDGLEAGDRIITRVEIELEKNAPVSAEHLLNTLEMEEGRLRIKFRTDTFTSI
EPRPFYDLPEENVDMRERGVVTVRNRGVDEGVVYVYRRDRTPVESHNVVGRVRRGMELLD
VVAEGDRVLVETDPPRVNFVGLTVDEARELAEEFDVELEVNGDGDVVVDQEPRETLNVLK
ERKVRVEVVPEDEVIEIELYEDDAPRSVEYFRRVTKMLDRPVGRLKVHFAYADLGMIVFE
GNEKLGKKLPPENNPKDRVEAGVLGVTNQAKPHAGLIGVRLEDSEEYGPTGETFEGTNVI
GRVVEGLGRLREMDQSDMGRTVYVREVRGER
Download sequence
Identical sequences Q8TX79
190192.MK0796 gi|20094233|ref|NP_614080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]