SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20094842|ref|NP_614689.1| from Methanopyrus kandleri AV19

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20094842|ref|NP_614689.1|
Domain Number 1 Region: 176-424
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.98e-24
Family Terpene synthases 0.057
Further Details:      
 
Weak hits

Sequence:  gi|20094842|ref|NP_614689.1|
Domain Number - Region: 10-195
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000141
Family Terpene synthases 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20094842|ref|NP_614689.1|
Sequence length 458
Comment Terpene cyclase/mutase [Methanopyrus kandleri AV19]
Sequence
MGILRPLVLALVTVALSTAPGSAITAEQIQECARAAHDWLKSQQYTEEDVGKVIEYKDRS
GQKATYEVKPEDVGAFPMSYKSDVTYYCLPNLHTYVVMDTLLTAVEVGYPVDKDMVLKAL
QYMWNVKGKYQRKEDPNGEWAYWARIKDGKEIPSAGLTAKFALPFFRARQAGIVPDDKWN
EYKPFLEKVINWLREGPNLQKEDKGYCWIDYPDRPGGAHGITDVTSYCLRMLLAAGTSPD
DELILKVVEWFLNNQDEKGNFYTDPRDTGCPYPLYTTGHCRAMIALCDWLEAVQRAGKED
ELKDLVERVKNALKKAIDYLLSLRDPETGMWGRGSLSEYPPDYGSTASALVALLRCAKLG
LIDPNHEAIVKALEVLHGQYLEAKRLRLPFYWYFIRSVWSPELRYRSQTLATSYALAAFA
LAEKLGVGKGVVKKRKIFPVTPAVVALALAASLLTRRR
Download sequence
Identical sequences Q8TVI3
gi|20094842|ref|NP_614689.1| 190192.MK1406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]