SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20094923|ref|NP_614770.1| from Methanopyrus kandleri AV19

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20094923|ref|NP_614770.1|
Domain Number 1 Region: 7-63
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 7.46e-16
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20094923|ref|NP_614770.1|
Sequence length 65
Comment methyl coenzyme M reductase, alpha subunit, fragment, partial [Methanopyrus kandleri AV19]
Sequence
MVERSKEEALFIKALKEKFEEDPEEKHTKFYVYGGYRQSPRKEFAKGALREFEPAGERDL
IVPAE
Download sequence
Identical sequences Q8TVA5
gi|20094923|ref|NP_614770.1| 190192.MK1487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]