SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20094092|ref|NP_613939.1| from Methanopyrus kandleri AV19

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20094092|ref|NP_613939.1|
Domain Number 1 Region: 6-252
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.45e-127
Family Methyl-coenzyme M reductase gamma chain 0.000000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20094092|ref|NP_613939.1|
Sequence length 257
Comment methyl coenzyme M reductase, gamma subunit [Methanopyrus kandleri AV19]
Sequence
MAEKAQFYPGETDVAENRRKYMNPNYELKKLREIPDEDIVRLMGHREPGEEYPSVHPPLE
EMEEPECPIRELVEPTEGAKAGDRIRYIQFTDSVYFAPIHPYIRARMYMWRYRGVDTGSL
SGRQIIEVRERDLEKIAKELLETEIFDPARSGVRGATVHGHALRLDENGLMFDALRRYRL
NEETGEVEYVKDQVGIELDEPIPVGAPADEDDLKERTTIYRIDGTPYREDEELLQVVQRI
HELRTLAGYRPEEAEGK
Download sequence
Identical sequences Q8TXL0
gi|20094092|ref|NP_613939.1| 190192.MK0654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]