SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000260 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000260
Domain Number 1 Region: 1001-1168
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.26e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000596
Further Details:      
 
Domain Number 2 Region: 443-643
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-44
Family DBL homology domain (DH-domain) 0.00062
Further Details:      
 
Domain Number 3 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 1.44e-29
Family Bcr-Abl oncoprotein oligomerization domain 0.0000449
Further Details:      
 
Domain Number 4 Region: 656-719
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000578
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000260   Gene: ENSMEUG00000000272   Transcript: ENSMEUT00000000285
Sequence length 1222
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_1515:11178:61703:1 gene:ENSMEUG00000000272 transcript:ENSMEUT00000000285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDPVGFAEAWRAQFPTSEPPHMELGSVSAIEQELQRCQASIRRLELEVNQERFRMIYLQ
TLLAKERKSYDRRRWGCGPRAPGGQPRRRPAARASPRPKRGAATRSAGSPGRARPSTLGA
PPQQPASVAALRSTFERARRPGEGEEKPFYVNVEYHHERGLVKVNDKEVSDRISCLGSQA
MQQERKKTSLGAATCRGPRRGHHRASRSTVRAGYCEPGGEYEDAELNPRFLRDNLISAQP
PGDYQPYQSIYVGSLMGDEGRGPSLEQDKPLTWPRRSYSPRSFEDIGGGYTPDCSSNENL
TSSEEDFSSGPSPTAPGRRSPSQNSQQSLDSSSPPTPQAQKRPRPGQVIVAEATIVGVRR
TGHIWPGDDGGAFPGDPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXSELDSEKGLEMRRWVLSAILDSEKTYLGHLEALLLPMKPLKA
AATTSQPVLTGQQIDTIFFKVPELYEIHKEFYDGLGPRVEHWSQQQQVGDLFQKLASQLG
VYRAFVDNYEAAIEMADRCCQANAQFAEISENLRARSMKDSKDQTTKNSLETLLYKPVDR
VTRSTLVLHDLLKHTPPSHPDHPLLQDALRISQNFLSSINEEITPRRQSMTIKKGEHRQL
LKDSFMVELVEGARKLRHVFLFTDLFLCAKLKKQMAGKSQHYECKWYVPLTDLSFQNLDE
AETAPAIPLVPDEELDAMKMKISQIKSDIQREKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXSYTFLISSDYERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXDEPTGLYGFLNVIVHSATGFKQSSXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDPQA
LQDKDWQRAVITMNGVEVKLSVKFTSREFSLKRMPSRKQTGVFGVKIGIVTKRERSKVPY
IVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLK
LYFRELPEPLFTDELYPSFAEGIALSDPVAKESCMLNLLLSLPEPSLLTFLFLLDHLKRV
AEKEPINKMSLHNLATVFGPTLLRPSEKESKVPPTPSQPITMADSWSLEVMAQVQVLLYF
LQLETLPAPDTKRQSILFSTEV
Download sequence
Identical sequences ENSMEUP00000000260 ENSMEUP00000000260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]