SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000675 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000675
Domain Number 1 Region: 621-768
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-28
Family DBL homology domain (DH-domain) 0.00000428
Further Details:      
 
Domain Number 2 Region: 906-963
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000264
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 379-524
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000614
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 4 Region: 112-197
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000366
Family CRAL/TRIO domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000675   Gene: ENSMEUG00000000719   Transcript: ENSMEUT00000000731
Sequence length 1078
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_3771:11143:231252:-1 gene:ENSMEUG00000000719 transcript:ENSMEUT00000000731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFWLKEDEMSHQELTQRLATVITHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEAASIGFIIVIDRRRDKWNSVKASLT
RIAGAFPGNLQLVFVLRPSRFIQRTIADIGIKLYRDDFKMKVPIIMLNSVSDLHGYIDKS
QLTRELGGTLEYGHGQWIHHRTAIENFALTVKTTAQMLQTFGTDLAETELPNDVQCTEQL
LHSHTEQHSKLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLAQLD
ETEKAFDQFWTKHYLKLNQCLQLRHFEHNFREXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXEPLEKAQSLAVTGDQLIQSNHYAVDSIRPKCVELRRICDDFTNEAKKK
CDILGKALEMHKQLDETSQWCEAGIYLLASQALDKCQTQEGAETALGDIEKFLSTAKEHQ
LVNPKEFYNQFNMVLTPEVKENAEKIVQKLEDVQEMFERRQISLKKLAAKQTRPVQPVAP
HPESSPKRASPKTNRPTNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXHIMHELIETERVYVEELQSIIEGYAAEMDNPELNHLIP
VALQNKKEILFGNLHEIHEFHNRIFLKELENCVENPEFLGRCFLKRXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXECQRKLDHKLSLDAYLLKPVQRITKYQLLLKXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXMGMVGITENVKGDSKKFEIWYNGREEVYIIQASSVELKNLWVSEIRKVLTGQLEA
CRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWPSRQLPSMDTFE
DFEVIPSSTEDLEEDASNHNVSGLFRVEGSYETCSPDSLTLEDGECSGENGQCGDKEE
Download sequence
Identical sequences ENSMEUP00000000675 ENSMEUP00000000675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]