SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000695 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000695
Domain Number 1 Region: 72-218
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-30
Family DBL homology domain (DH-domain) 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000695   Gene: ENSMEUG00000000756   Transcript: ENSMEUT00000000753
Sequence length 220
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4936:33751:64571:1 gene:ENSMEUG00000000756 transcript:ENSMEUT00000000753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKEAFGKENMGTKKKNLTFLRQRFYMLERRKTDTVVESSVAVDHSNCGPLRRSQSDRT
EYNQKLQEKMTPQAEASAPGPTAQVEQQIRRMMAKRSNIIKELIQTEKDYLNDLELCIRE
VVQPLKNKQIDRFDVDGLFSNIQSVHQISAKLLSLLEEATTDVDPAMQVIGGVFLQIKNP
LEDIYKIYCYHHDEAHTMLESYEKDEELKEHMTHCIQSLK
Download sequence
Identical sequences ENSMEUP00000000695 ENSMEUP00000000695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]