SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000900 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000000900
Domain Number - Region: 106-154
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00137
Family Ricin B-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000900   Gene: ENSMEUG00000000973   Transcript: ENSMEUT00000000978
Sequence length 506
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7929:12813:45165:-1 gene:ENSMEUG00000000973 transcript:ENSMEUT00000000978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LILGSHGAIMPGAKVVVSKPIFGEDEWLLEPKEKQEKENAEDAPPETLNSHERDLVPRQK
HCRVAWQLTPSNSEDAQEEKRFFKNVESYKKLSSSLKLRVLRKACHQQFEFKDGHISNSS
IPNLVLGVQRLNLRSGSGVVLVRKNSYDKYQKWLHKEETXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXRYKPYYNGASNQKWLYLKNSNTLKAFYSTXXXXXXXXXXXXXXXXXXXX
XXXXXXXXGYYFCLPGSKRKIMICLACAQSMVTRKDLKKVLPGHKFLCSFGSKEYKQLCL
RNTKATLANQSDLSSCEDENSLRHHEELLFSSTKLCTVSHNILATLRQTPVKVIAHKNGT
ISPNGKLVVAQSFPMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXKASQGEIKSSPQSIMSAYLCSFNASLLTLILKNPIEVWVS
CGEPFIPNEKIRKTEKELAKEGQNFG
Download sequence
Identical sequences ENSMEUP00000000900 ENSMEUP00000000900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]