SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001041 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001041
Domain Number 1 Region: 94-326
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.26e-36
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000171
Further Details:      
 
Domain Number 2 Region: 466-552
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.43e-24
Family Ricin B-like 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001041   Gene: ENSMEUG00000001129   Transcript: ENSMEUT00000001134
Sequence length 556
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5419:758:60378:1 gene:ENSMEUG00000001129 transcript:ENSMEUT00000001134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRFVYCKVALATSLMWVLVDVFLLQYFSECNKCDDKKERYLLPALRAVISRNQEGPGEM
GKAVRIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVV
IVFHNEAWSTLLRTVYSVINRSPHYLLSEIILVDDASERDFLKMALENYVKNLEVPVKII
RMEQRSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKENXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPTMAGGLFSIDRN
YFEEIGAYDAGMDIWGGENLEMSFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFSYTAEKEIRTDDF
CLDVSRLSGPVIMLKCHHMRGNQLWEYDAEKLTLRHINSNQCLDEPSEDDKMVPTMKDCN
GSRSQQWLLRNMTLSA
Download sequence
Identical sequences ENSMEUP00000001041 ENSMEUP00000001041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]