SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001043 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001043
Domain Number 1 Region: 78-153
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.06e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001043   Gene: ENSMEUG00000001133   Transcript: ENSMEUT00000001136
Sequence length 221
Comment pep:known_by_projection scaffold:Meug_1.0:Scaffold198318:1207:1923:1 gene:ENSMEUG00000001133 transcript:ENSMEUT00000001136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLVDSNLSDFETSSDLSCFLTDEEDGSGLLPAASSVPLSAAPETRAEGGRREEDKERK
RRRGRGRVRSEALLHTIRKTRRVKANDRERNRMHNLNAALDELRSVLPTFPDDTKLTKIE
TLRFAYNYIWALAETLRLADQCLQGPPKELLLPAYLHPADSPSSASDGESWLSSASPASP
LSNPSSPAASEDFGYGNPDPLFFPGLPKDLAHGAPCFVPYR
Download sequence
Identical sequences ENSMEUP00000001043 ENSMEUP00000001043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]