SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001064 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001064
Domain Number 1 Region: 54-156
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.54e-25
Family DEP domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 189-282
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000677
Family Pleckstrin-homology domain (PH domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily PH domain-like 0.00000177
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001064   Gene: ENSMEUG00000001156   Transcript: ENSMEUT00000001159
Sequence length 284
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_1624:255:5458:-1 gene:ENSMEUG00000001156 transcript:ENSMEUT00000001159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLIKLRTRTSTDYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHIMKNSFRLPSHISL
HNIIEKMQDSSCGIRPSPNMEQGSTYKKTFIGSSLVDWLISSHFAASRIEAVTLASMLME
ENFLKPIGNRSTEAIRSGDLAEQFLDDSTALYTFXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXGHKRKNWKVRRFVLRSDPAFLHYYNPSKXXXXXXXXXXXXXXXXXXXXXXXX
XXXVKGNVQGNLFKVITKDDIHYYIQASSKAERVEWIEAIKRLT
Download sequence
Identical sequences ENSMEUP00000001064 ENSMEUP00000001064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]