SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001548 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001548
Domain Number 1 Region: 1324-1464
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-45
Family Pleckstrin-homology domain (PH domain) 0.000028
Further Details:      
 
Domain Number 2 Region: 1120-1168,1212-1327
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.42e-38
Family DBL homology domain (DH-domain) 0.000000822
Further Details:      
 
Domain Number 3 Region: 509-624
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-20
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000001548
Domain Number - Region: 961-999
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0327
Family PDZ domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001548   Gene: ENSMEUG00000001681   Transcript: ENSMEUT00000001696
Sequence length 1724
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5604:1401:117450:1 gene:ENSMEUG00000001681 transcript:ENSMEUT00000001696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSESQYSLQGSKNHSSSATGAKQKPCPLKIRSIHAKDEKSCSLHGWGHGSSGTNYKSR
SLARSCLSHFKSNQPYSSRLSDPMAKGSKGSTHTKHXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPKSKDGYDHLDTRTDGLSA
EALLPSQLSSLLWSGGAGQTLPQRSESTNAISSDPLRQNIYENFMRELEMSRTHVENIET
STETADSSSDSLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTLQKEKKLELVARRKWKQY
WVTLKGCTLLFYETYGRNSMDQSSSPRCALFAEDSVVQSVPEHPKKENVFCLSNSFGDVY
LFQATSQTDLENWVTAIHSACASLFAKKHGKEDTVRLLKNQTKNLLQKIDMDSKMKKMAE
LQLSVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSR
PSKLALGRLGILSVSSFHALICSRDESALRKRTLSLTQQGQSKKGLFSSLKGLXXXXXXX
XXXXXXXXXIFDSSGNHGFPGTQLPQSSNNSSEXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LRTGNEILSINGEVVSDLDLRQMETLFSERSVQLTLKTNPLDTKQTLGTSWSDSDLSRDQ
KNLLPPPNQSQLLEEFLDNLKKNTANDFSNVPDVTAGLKRSQTDGTLDQVPHREKTEHTF
RSAEQIAVLCRNFHDSQTDAMEGPKEAQEPPPRPLARHLSDADRLRKVIQELMDTEKSYV
KDLTCLFELYLEPLQSETFLTQDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXFLYYADHFKLYSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTK
QHASTLESYLIKPVQRVLKYPLLLKELVSLTDNESEEHYHLTEALKAMEKVASHINEMQK
IYEDYGTVFDQLVAEQSGTEKEVTELSMGELLLHSTVSWLNPFLSLGKARKDLELTVFXX
XXXXXXXXXXXXXXXXXXPSSSRPSHVHGDLDPFKFRWLIPLSALQVRLGNAAGTENSSI
WELIHTKSEIAGRPETVFQLCCXXXXXXXXXXXXXXXXXXEFRRHIKSELPLKTCKDRLI
PLKNRVPVSAKLASSRSLRVLKNSSSNEWNSDTGKGNLLDSDECSLSSSTQSSGCHTTES
RQESKDSSPEKYPQTCSSDFSDSLIKESDILSDEDDDFHQTLKKGSPTKDIEIQFQRLKI
SEDPDGGSTTDQEPRTEDGNNHSSAEHPRLVRGHFCPIKRKANSTKRDRGTLLTLQTRHQ
SLDSKSENANIDLNSLLEREFSVQSLTSVVNEECFYETESHGKS
Download sequence
Identical sequences ENSMEUP00000001548 ENSMEUP00000001548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]