SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001581 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001581
Domain Number 1 Region: 543-725
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-51
Family DBL homology domain (DH-domain) 0.000000157
Further Details:      
 
Domain Number 2 Region: 729-860
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-34
Family Pleckstrin-homology domain (PH domain) 0.00000266
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000001581
Domain Number - Region: 321-371
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000389
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number - Region: 109-142
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00157
Family CRAL/TRIO domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001581   Gene: ENSMEUG00000001718   Transcript: ENSMEUT00000001734
Sequence length 961
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_1810:50168:103426:-1 gene:ENSMEUG00000001718 transcript:ENSMEUT00000001734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRGKDNDWIITFPENSNFREVPEDVLTKVLTYLTSLPRQHEPDTKFILILDRRLDTWASV
KITLQRIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVMLSSVSDLLS
YIDEKQLTPEFGGTLEYCHSEWVIFRTAIENFALTVKEIAQMLQSFGTELAETELPDDAF
SIEQLLTIRTEKYFQLKEEIVSVMKEGNMLLRTFEVPNTKESNEETPQEKSGDWETVNRL
LAQLHEMEVAFDEFWDKHQLKMDQYVELWKFEQNFLEXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXELTGKANLLILHGHQLVANHHYALDLICQRCNELRHQTDGLSE
ELKAKEKKLTKTLELQNRLHQALLCCDEGAYLLANQPMDKCQAKEGAQKALYDIEKFLDV
TLPNLKYDPVSLQREFEVIXXXXXXSQIQAVQVKLENIRSVFQNRQNCFRKLTNKHSRPV
QPVVPQPESSGKSKSPLFSPKHGKKPRKNQNSLKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXHVIKELIETERVYVDELFSILVGYREEMDNPLMAALIPPVLKNKKDVLFGNMPEIY
EFHSKIFLHSLESCLEVPQRMGLCFLERRNDFQIYEKYCQNKPRSELLWRQCSESAFFAE
CQKKLDHKLALDSYLLKPVQRLTKYQLLLKELLKYSANSEGVQQLQEALLSMLDLLKSVN
DSMHQTAITGYDGNLSDLGRILMQGSFSVWISHRKGSTKMKDFARFKPMQRHLFLYEKAI
VFCKKRDEHGEGHERTSFYSFKHYLKMSAVGITENVKGDNRKFEICYSGREEVYIVQAQT
MESKAAWLSEIRKILIKQQELIKXXXXXXXXXXXXXXXXXXXXXXXXXMQQRVSISSEEN
ESDHTSPGTSDNVALSPQIKTSKSSSRTSLTLELGESLEEWINNSFLLAFSDTEEEDGSQ
L
Download sequence
Identical sequences ENSMEUP00000001581 ENSMEUP00000001581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]