SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001640 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001640
Domain Number 1 Region: 88-198
Classification Level Classification E-value
Superfamily Second domain of FERM 5.36e-39
Family Second domain of FERM 0.000000807
Further Details:      
 
Domain Number 2 Region: 497-585
Classification Level Classification E-value
Superfamily Moesin tail domain 2.22e-32
Family Moesin tail domain 0.0000258
Further Details:      
 
Domain Number 3 Region: 199-264
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-24
Family Third domain of FERM 0.000029
Further Details:      
 
Domain Number 4 Region: 32-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-16
Family First domain of FERM 0.0000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001640   Gene: ENSMEUG00000001793   Transcript: ENSMEUT00000001799
Sequence length 585
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_1406:3497:42582:-1 gene:ENSMEUG00000001793 transcript:ENSMEUT00000001799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVPEELIQDITQKLFFLQVKDGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEMHKAGYLSSERLIPQRVMDQHKLSREQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXQQLESEKKKRETVEREKEQMLREKEELMQRLQDYEQKTRK
AEKELSDQIQKAIQLEEERKRAQEEAERLEADRVAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQLRAREAQDDLVKTKEELHHVMTAPPPPPPVYEPV
NYHPQENLQDEGTEYSGYSAEFSSEGIMDDRNEEKRITEAEKNERVQRQLQTLTNELSLA
RDENKRTPNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences ENSMEUP00000001640 ENSMEUP00000001640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]