SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001650 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001650
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-32
Family C-type lectin domain 0.0000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001650   Gene: ENSMEUG00000001806   Transcript: ENSMEUT00000001810
Sequence length 142
Comment pep:novel scaffold:Meug_1.0:Scaffold54000:22060:24088:-1 gene:ENSMEUG00000001806 transcript:ENSMEUT00000001810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEKAPAPPSARSSCPQGFGFYDSYCYGWVLETWNTAELLCQSYPSGHLGSLLNEGETSFV
ATMIMENEIGDNPVWIGLHDPTKKRRWRWSSNALYLYQAWETGSPGKTSPNYCAALTPQS
EFRSWKDEPCQKEYLYLCKFEA
Download sequence
Identical sequences ENSMEUP00000001650 ENSMEUP00000001650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]