SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001997 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001997
Domain Number 1 Region: 609-880,918-978
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-86
Family Ras GEF 0.000000000172
Further Details:      
 
Domain Number 2 Region: 200-385
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-32
Family DBL homology domain (DH-domain) 0.000000464
Further Details:      
 
Domain Number 3 Region: 409-518
Classification Level Classification E-value
Superfamily PH domain-like 5.07e-23
Family Pleckstrin-homology domain (PH domain) 0.00000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001997   Gene: ENSMEUG00000002171   Transcript: ENSMEUT00000002192
Sequence length 1320
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_1617:22638:114400:-1 gene:ENSMEUG00000002171 transcript:ENSMEUT00000002192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPQQPYDFFSEENHPKWRGLFVPALRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLMDMFDQDI
GLVSLCEDEPFSSGELNYYDLVRTEIARYLELNLKVFGAFLSNKKLFASSDIEGIFSNIL
DIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDILSPQFHER
FNTLMAKPAVSLHFQSIADGFKEAVRYVLPRLMLVPVYHCSHYFELLEQLQACSEEHLDR
ECLNQAITALLNLRCIMERICNKHSPRXXXXDPVCRFYNRQSRSKHLAIKKMNEIQKNID
GWEGKDIGQCCNEFIMEGPLMRIGAKHERHIFLFDGLMISCKTNHGQSRIPGYSNAEYRL
KEKFIMRKIQICDDDTSEYKHAFELISKDENSIIIAAKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXPNFVRTFLTTYRSFCKPQELLKLLIERXXXXXXXXXXXXXXXXEKGEQPIS
ADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLEKLESFISSVKGKTMKKWVE
SIVKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQYETFDLMTLHPIEIARQLTLL
ESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCLVEAENFEERVAV
LSRIIEVLQVFQDLNNFNGVLEIVSAVNSVPVYRLDHTFEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXIYLTNILKTEEGNNDFLKKQGKELINFSKRRKVAEITGEI
QQYQNQPYCLRIESEIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRKT
TFSLKSPGIRPHAGRHGSTSGTLRGHPTPLEREPCKISFSRINEAEHESAASAPTSPNTP
STPPVSASSDLSVFLEIDLNSSCGSNSIFAPVVLPHSXXXXXXCGSHKLTEEPVVPPPLP
RKKFDQDVSTSKGNLKYDDDPPAIPPRQPPPPKIKPRVPAYSGPFEGPLPSPPPPPPRDP
LPETPPPVPLRPPEHFINYPFNLQPPPIGHTHRDPDWFREASTCPNSPNTPPSTPSPRVP
RRCVLSSSQNNLAYSQAPPIPPRQNSSPHLPKLPPKTYKRDLCQPPMYRLSLLENAETPQ
Download sequence
Identical sequences ENSMEUP00000001997 ENSMEUP00000001997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]