SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002226 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002226
Domain Number 1 Region: 629-697,929-973,1015-1083
Classification Level Classification E-value
Superfamily Ras GEF 1.1e-30
Family Ras GEF 0.0044
Further Details:      
 
Domain Number 2 Region: 232-382
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-29
Family DBL homology domain (DH-domain) 0.0018
Further Details:      
 
Domain Number 3 Region: 23-127
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-20
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 4 Region: 1176-1236
Classification Level Classification E-value
Superfamily Ras GEF 0.00000000000523
Family Ras GEF 0.0031
Further Details:      
 
Domain Number 5 Region: 431-585
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000295
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002226   Gene: ENSMEUG00000002427   Transcript: ENSMEUT00000002445
Sequence length 1238
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_563:464:111708:-1 gene:ENSMEUG00000002427 transcript:ENSMEUT00000002445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGIRLNDGHVTYLGLLAKKDGTRRGYLSKRSSDNTKWQTKWFALLQNLLFYFENDSSS
RPSGLYLLEGCVCDRAPSPKPSLSGKESLEKQHYFTVNFNHENQKALELRTEDAKDCDEW
LAAITHAXXXXXXXXXEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAS
LLKDNDRIQSIQTVTPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKPPITHDDVSSIFLNSETIMFLHQ
IFYQGLKARISSWPTLVLADLFDIMLLMLNFYQEFVRNHQYSLQILAHCKQNRDFDKLLK
HYEAKPDCEERTLETFLTYPMFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
IMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGS
LSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKXXXXXXXXXXXXXXXXXXXXXXKTSGQ
DIDHLDFKIVVEPKDSPSFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENSK
VTVPQMIXXXXXXXXXXXXXXSDASLYCDDVDIRFSKTMNSCKVLQIRYASVGRLLERLT
DLRFLSIDFLNTFLHSYRVFTTAVVVLDKLITIYKKPISAIPARSLELLFASGQNNKLLY
GEPPKSPRANRKFSSPPPLSITKSSSPSRRRKLSLNIPIITGGKALDLAALSCSSNGYAS
MYSSMSPFSKTTLDISKSYVFSNFPNKIPDEGEGTAEKIEDSSPNKQSSEVSVREESDND
QNQSDDADTETSPTKSPTTPKSIKSKNASEFSLFSYNNGVVMTSCRELDNNRSALSAASA
FAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKH
SQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
AEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKVEKNERTPYIMKTTKH
FNDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCDPPCVPYLGMYLTDLAFIEEGTP
NYTXXXXXXXXXXXXISHIIREIRQFQQTAYKIEHQAK
Download sequence
Identical sequences ENSMEUP00000002226 ENSMEUP00000002226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]