SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002233 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002233
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000401
Family Spermadhesin, CUB domain 0.0096
Further Details:      
 
Domain Number 2 Region: 132-167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002233   Gene: ENSMEUG00000002449   Transcript: ENSMEUT00000002452
Sequence length 175
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5265:18220:21053:1 gene:ENSMEUG00000002449 transcript:ENSMEUT00000002452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLVDFCDQMLQGDGMIVRSHPDSQKFYFVATETDCWLTVQAASPQERVLFQFRFFLVYSL
TQAPPATEDPCTTGSYLQFYKGQPGESRLGNPLCGVTIPGPVLSTGRSLSLRLVTRGQQP
RVDFIGDFTSFRLGPFYFLCRNKRCIPQSLVCDTWGIDNCGDGSDQTSNPPASCS
Download sequence
Identical sequences ENSMEUP00000002233 ENSMEUP00000002233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]