SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002435 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002435
Domain Number 1 Region: 158-212
Classification Level Classification E-value
Superfamily C-type lectin-like 1.3e-23
Family Link domain 0.022
Further Details:      
 
Domain Number 2 Region: 49-155
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-16
Family V set domains (antibody variable domain-like) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002435   Gene: ENSMEUG00000002670   Transcript: ENSMEUT00000002675
Sequence length 214
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5539:4882:27617:-1 gene:ENSMEUG00000002670 transcript:ENSMEUT00000002675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLLFLVLISLSWADHLTDNYTLEHDRIIHIQAENGPRLLVEAEQAKVFSHRGGNVTLP
CKFYRDPSTIGSGTHKIRVKWTKLTSDYLKEIDVFVSMGYHKKTYGTYQGRVFLNRGSDN
DASLVITDITLEDYGRYKCEVIEGLEDDTAVVALDLQGVVFPYFPRLGRYNLNFHEAQQA
CLDQDSVIASFDQLYDAWRAGLDWCNAGWLSDGS
Download sequence
Identical sequences ENSMEUP00000002435 ENSMEUP00000002435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]