SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002475 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002475
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 2 Region: 125-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000458
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002475   Gene: ENSMEUG00000002713   Transcript: ENSMEUT00000002720
Sequence length 171
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_8391:5447:11433:1 gene:ENSMEUG00000002713 transcript:ENSMEUT00000002720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGGSGRCAGRVEVYYQEVWGTVCDDLWDLNEAEVVCRQLGCGQAVSAPGEAHFGPGSGNI
LLDNMQCAGTEGYLGQCSHSGWSNHNCGHHEDAGVICSXXXXXXXXXXXXXXXXXXXXXX
XRINSCGGVISSLSGSFSSPQYPGNYPTDIYCVWEIHVDKKFHIELMIPNL
Download sequence
Identical sequences ENSMEUP00000002475 ENSMEUP00000002475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]