SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002665 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002665
Domain Number 1 Region: 211-307
Classification Level Classification E-value
Superfamily EF-hand 1.04e-29
Family Eps15 homology domain (EH domain) 0.0012
Further Details:      
 
Domain Number 2 Region: 1251-1432
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.44e-27
Family DBL homology domain (DH-domain) 0.000000202
Further Details:      
 
Domain Number 3 Region: 1137-1219
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-26
Family SH3-domain 0.0000577
Further Details:      
 
Domain Number 4 Region: 1589-1709
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.59e-26
Family PLC-like (P variant) 0.0088
Further Details:      
 
Domain Number 5 Region: 1435-1553
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-24
Family Pleckstrin-homology domain (PH domain) 0.000000775
Further Details:      
 
Domain Number 6 Region: 910-972
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-19
Family SH3-domain 0.0000918
Further Details:      
 
Domain Number 7 Region: 998-1057
Classification Level Classification E-value
Superfamily SH3-domain 9.84e-19
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 8 Region: 727-808
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-18
Family SH3-domain 0.00023
Further Details:      
 
Domain Number 9 Region: 1071-1141
Classification Level Classification E-value
Superfamily SH3-domain 1.17e-17
Family SH3-domain 0.0000817
Further Details:      
 
Domain Number 10 Region: 7-105
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000641
Family Eps15 homology domain (EH domain) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002665   Gene: ENSMEUG00000002902   Transcript: ENSMEUT00000002927
Sequence length 1716
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9935:5260:175075:1 gene:ENSMEUG00000002902 transcript:ENSMEUT00000002927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTSFGGSLDIWAITVEERAKHDQQFHSLKPTSGFITXXXXXXXXXXXXXXXXXXXX
XXALADMNNDGRMDQIEFSIAMKLIKLKLQGYQLPAALPPVMKQQPVAISGAPTFGIGGI
ASMPPLTAVAPVPMASIPVVGMSPPLVSSVATTAVPPLANGAPSVIQPLPAFTAATLPKS
SSFSRSGPGSQLNTKLQKAQSFDVASASTVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTG
PQARTILMQSSLPQTQLATIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLPPE
YIPPSFRRVRSGSGISVISSVSVDQRLPEEPALEEEQQLEKKLPXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXERKERERQEQERKRQVELEKQLEKQRELERQR
EEERRKEIERREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVVLKARKKTLEFELE
ALNDKKHQLEGKLQDIRCRLAMQRQEIESTNKSRELRIAEITHLQQQLQXXXXXXXXXXX
XXXXXXXXLKQVQQNSLHRDSLLTLKRALEAKELARQQLRDQLDEVEKETRSKLQEIDIF
NNQLKELREIHNKQQLQKQKNLEAERLKQKEKERKTIELEKQKEETQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXKSPLAISTQEDVKVVYYRALYPFESRSHDEITIQPGDIVMVIGYCVDESQTGEPG
WLGGELKGKTGWFPANYAEKIPENEIPTPLKPGADSTPMPTPKLALHETPTPATTTSSES
STTSNNWADFSSTWPTNTNEKPETDNWDAWATQPSLTVPSAGQLRQRSAFTPATVTGSSP
SPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPK
SYVKLISGPIRKSTSMESSSSESPAVLKRVASPAAKLSVPGEEYIAMYTYESSEQGDLTF
QQGDVILVTKKDGDWWTGTVADKSGVFPSNYVRLKDSEXXXXXXXXXXXXXXXXIAQVIA
SYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKI
TPTEPPKSIALPTVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQVGL
FPSNYVKMTTDMDPSQQWCADLHLLDMLTPTEKRGYIHELLVTXXXXXXXXXXXXXIFQK
PLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGERMPVKMIGDILTAQLPH
MQPYIRFCSCQLNGAALIQQKTDEVPEFKEFVKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXILENTPENHPDYSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGL
SEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQIIKPLGSSGTDKVF
SPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXRSQRATGIGRLMVNIVEGIELKPCWSHGKSNPYCEVTM
GSQCHITKTIQDTLNPKWNSNCQFFIKDLEQDVLCITVFERDQFSPDDFLGRTEIRVADI
KKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP
Download sequence
Identical sequences ENSMEUP00000002665 ENSMEUP00000002665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]