SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002744 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002744
Domain Number 1 Region: 136-264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-18
Family Clostridium neurotoxins, the second last domain 0.034
Further Details:      
 
Domain Number 2 Region: 1410-1477
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000133
Family Complement control module/SCR domain 0.0056
Further Details:      
 
Domain Number 3 Region: 1341-1413
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000347
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 4 Region: 1279-1349
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000959
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000002744
Domain Number - Region: 670-694,875-934
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00771
Family Fibronectin type III 0.0079
Further Details:      
 
Domain Number - Region: 355-469
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0161
Family Reprolysin-like 0.059
Further Details:      
 
Domain Number - Region: 1549-1578
Classification Level Classification E-value
Superfamily Notch domain 0.0379
Family Notch domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002744   Gene: ENSMEUG00000003002   Transcript: ENSMEUT00000003014
Sequence length 1622
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_8757:809:164022:1 gene:ENSMEUG00000003002 transcript:ENSMEUT00000003014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLWSLVLTLGLLCGALASGAECGMDERSRRARRDTRPSRHLHSAAPTCATRLARGRHSP
PWEPLRAPRTRQQREVKGEEDSLIPSRALYFSXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXLYDKCSYTSRDRGWAVGIHTISDQGSRDPRYFFSMKTDRARKVTAISAH
RSYLPNQWVHLAATYDGRLMKLYVNGAQVAMGGEQVGGIFSPLTQKCKVLMLGGNALNHN
YRGYIEHFSLWKTARSQKEIILDMGRANHGLGTGLPQLVIQENLENMKSMWSSMKDGSSP
QVEFGYHHGLLLDTSLEPPLCGQTLCDNVEVIASYNQLPSFRRPKLVRYRVVNIYDDNHE
NPTVSQQQIEFQHQQLIEAFDRYNITWQLEVLEVKNSSLRHRLILANCDISKIGDENCDP
ECNHTLTGYDGGDCRHLRHSAFSKKKQNGICDMDCNYERYNFDGGECCNPEITDVTKTCF
DPDSPYRAYLDVNELKNILKLDGSTHLNIFFANSSEEELAGVATWPWDKEALMHLXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPNQVARMHCYLDLVYQSW
QPAQKPAPIALTPQIVDRTPTSVTLEWFPPIDGHFFEREVGSACDLCLEGRVLVQYAFNA
SSPMPCDPSGHWSPREAEGHPDVEQPCKSSVRTWSPNSAVNHHTVPPACPEPQGCYLELE
FQYPLIPESLTIWVTLVSTDWDSSGAVNDIKLLTLSGKNISLGPQNIFCDIPLTIKIRDV
GEEVYGIQIYTLDEHLEIDAAMLTSIPESPLCLDCKPLKYKVLRDPPFQSDIPIVISNLN
RRYVDMELSHGSTYKYQIVTISGTEESEPSPTAIYIHGSGYCGNGIIQKHLGEECDDMNK
INGDGCSLFCRKELYFNCIDEPSRCYFHDGDGVCEEFEQKTSIKDCGVYTPKGFLDQWAS
NASVSHQDQKCPGLVIIGQPAASQMCRTKVVDLSEEVSQHAWYPCTINYQYSYNTQTTFW
LKAYFSQPMVATAVIVHLVTDGTNYLDQKQETISVQLFDTKEQIHDLGVHVLSCRSNPLI
IPVIHDLSHPFYHSQAVLVSFSSPLVAISGVALRSFYNFDPITISSCQRGETYSPAEQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSESSV
TVTCTEGKWNKQVSCEPVDCGIPDQYHVYPATFSCLEGTTFGKKCSFQCRLPAQLKGNNS
FLTCMEDGLWSFPEALCELMCLAPPIMPNADLQTARCREDKHKVGSFCKYKCKPGYHVPG
SSRKSKKRAFKIQCTQDGSWLEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEES
DISSGRGSNVIHCRKDGTWSGSFHVCKEMQGQCSLPDQLNSNLKLQCSSGYEIGAECATS
CLDHNSESIILPTNMTVRDIPHWMNPTRVERVVCTAGLKWYPHPSMIHCVKGCEPFMGDN
YCDAINNRAFCNYDGGDCCASTVKTKKVTPFPMSCDLQGDCACRDPKAQEHSRKALRAHS
HG
Download sequence
Identical sequences ENSMEUP00000002744 ENSMEUP00000002744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]