SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002747 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002747
Domain Number 1 Region: 67-211
Classification Level Classification E-value
Superfamily C-type lectin-like 1.22e-36
Family C-type lectin domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002747   Gene: ENSMEUG00000003005   Transcript: ENSMEUT00000003019
Sequence length 217
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_7277:6:18030:-1 gene:ENSMEUG00000003005 transcript:ENSMEUT00000003019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDEDGYITLNFKSRTSIVTSVDPVFSWRPMALTLLFVCLGLTAGLVTLGIMFFKQQDYL
PTQNGNLSEILQKVAKIFCQGSKVVDHKCYLCDNNWRYHGDKCYGFFRHNLTWAESKRYC
TERNATLLKITSQDTLDFIKGRTSYIRWIGLSRRNSDGIWFWEDGSSLSKSVFNLLGNEK
DQHCAYFLKGKIYTSLCEDKHYLMCERKTNIVRIDQL
Download sequence
Identical sequences ENSMEUP00000002747 ENSMEUP00000002747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]